Prostatic Acid Phosphatase (248-286)

Supplier: Anaspec Inc

AS-64518
103008-214EA 621.15 USD
103008-214
Prostatic Acid Phosphatase (248-286)
Proteins and Peptides

Prostatic Acid Phosphatase (248-286), PAP (248-286) peptide is a semen-derived enhancer of viral infection (SEVI) factor found in semen. This peptide greatly increases HIV infection through enhanced virion attachment to target cells.
Sequence:GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY
MW:4551.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR