3 x Hemagglutinin (HA) Tag

Supplier: Anaspec Inc

AS-63764
103007-714EA 651.85 USD
103007-714
3 x Hemagglutinin (HA) Tag
Proteins and Peptides

This tag peptide may be used to detect proteins and peptides, and to facilitate functional analysis of proteins of interest.
Sequence:MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
MW:4372.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR