Human [Gln22]-beta-Amyloid (1-42)

Supplier: Anaspec Inc

AS-62142
103007-208EA 507.15 USD
103007-208
Human [Gln22]-beta-Amyloid (1-42)
Proteins and Peptides

This peptide is a naturally occurring mutant form of the wild type (WT) beta-Amyloid 1 to 42 peptide. The E22Q 'Dutch' mutant, also known as HCHWA-D, is caused by a point mutation in the beta-Amyloid encoding gene, with Glu replaced by Gln at position 22. Dutch E22Q mutation in beta-Amyloid causes familial cerebrovascular amyloidosis with abundant diffused amyloid plaque deposits. E22Q mutant and WT peptides are both stable in 'collapsed coil' conformations. The E22Q fibrils are more toxic for vascular cells than the WT fibrils.
Sequence: DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR