Bovine;Human;Pig Glucagon (1-29), FAM-labeled, FAM (Carboxyfluorescein)

Supplier: Anaspec Inc

AS-60273-1
103003-074EA 552.46 USD
103003-074
Bovine;Human;Pig Glucagon (1-29), FAM-labeled, FAM (Carboxyfluorescein)
Proteins and Peptides

This is a fluorescent (FAM)-labeled Glucagon peptide, Abs/Em=494/521 nm. Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycaemia.
Sequence: FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
MW: 3841.1 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR