Human Calcitonin Peptide

Supplier: Anaspec Inc

AS-20673 AS-20674
102998-448EA 268.92 USD
102998-448 102998-450
Human Calcitonin Peptide
Proteins and Peptides

Human calcitonin reduces blood calcium, opposing the effects of parathyroid hormone (PTH). It stimulates cyclic nucleotide accumulation in human kidney cortex and medulla. Calcitonin maybe involved in osteoporosis and in Paget's disease.
Sequence: CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
MW: 3417.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR