Human;Pig;Rat Viasoactive intestinal peptide

Supplier: Anaspec Inc

AS-22872 AS-22873
102996-314EA 153.46 USD
102996-314 102996-316
Human;Pig;Rat Viasoactive intestinal peptide
Proteins and Peptides

28-amino acid neuropeptide VIP (Vasoactive Intestinal Peptide) is a neurotransmitter and a neuromodulator.
Sequence:HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
MW:3325.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR