Polyclonal antibody to Glucagon Like Peptide 2 (GLP2), derived from OVA conjugated GLP2, is reactive with Human.
- High specificity, affinity and purity
- Extensive validation and batch-to-batch consistency
- Diverse range of conjugated and custom options
- Comprehensive validation data and documentation
- All in stock and fast global delivery
- 100% Quality and service satisfaction guarantee!
GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy.
Caution: For research use only. Not for use in clinical diagnostic procedures. Please proper stored each component based on the instruction.
Type: Primary
Antigen: GLP2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human