Mouse GLP2 ELISA Kit
Supplier: CLOUD-CLONE CORP MS
This assay has high sensitivity and excellent specificity for detecting Mouse GLP2 (Glucagon Like Peptide 2). The assay range is from 24.69 to 2000 pg/ml (Competitive kit) with a sensitivity of 9.22 pg/ml. There is no detectable cross-reactivity with other relevant proteins. Activity loss rate and accelerated stability test ect have been conducted to guarantee the best performance of the products after long storage and delivery.
- High sensitivity and specificity
- Perfect reproducibility and consistency across batches
- Quality control with three-level inspections
- Wide range of targets/species available
- Intra-assay: CV<10%; Inter-assay: CV<12%
GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone brea kDaown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy.
Caution: For research use only. Not for use in clinical diagnostic procedures. Please proper stored each component based on the instruction.
Learn more

About VWR
Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...