Mouse GLP2 ELISA Kit

Supplier: CLOUD-CLONE CORP MS

CED059MU
MSPP-CED059MUEA 720 USD
MSPP-CED059MU
Mouse GLP2 ELISA Kit
Assays ELISAs

This assay has high sensitivity and excellent specificity for detecting Mouse GLP2 (Glucagon Like Peptide 2). The assay range is from 24.69 to 2000 pg/ml (Competitive kit) with a sensitivity of 9.22 pg/ml. There is no detectable cross-reactivity with other relevant proteins. Activity loss rate and accelerated stability test ect have been conducted to guarantee the best performance of the products after long storage and delivery.


  • High sensitivity and specificity
  • Perfect reproducibility and consistency across batches
  • Quality control with three-level inspections
  • Wide range of targets/species available
  • Intra-assay: CV<10%; Inter-assay: CV<12%


GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone brea kDaown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy.


Caution: For research use only. Not for use in clinical diagnostic procedures. Please proper stored each component based on the instruction.

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR